DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and Clec11a

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001012477.1 Gene:Clec11a / 29313 RGDID:3627 Length:328 Species:Rattus norvegicus


Alignment Length:213 Identity:55/213 - (25%)
Similarity:86/213 - (40%) Gaps:45/213 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 RLARIETLQTAMNIRQKVLQ-------EGFPKDIVARLDRLESQQA---ALLRILSKFDRKIVAP 126
            |||.::.....::||..||.       :|..:...|..|..:|.||   ..:|...:..|.....
  Rat   119 RLASLDAGLHQLHIRLHVLDTRVVELTQGLRRLRDAASDTRDSVQALKEVQVRSEQEHGRLEGCL 183

  Fly   127 KFELIGSRFFYI--EDETRRNWTSAGSACRQMGTQLATIRSAEELAA----LRAKLNKER-HYWL 184
            |...:|.:.|.:  :.||:   .:|.:.|:..|..||.....:::.|    |||.|.... ..||
  Rat   184 KGLRLGHKCFLLSRDFETQ---AAAQARCKARGGSLAQPADRQQMDALSRYLRAALAPYNWPVWL 245

  Fly   185 DITDLEKEGDFRISASGKRPNFLKW-RAGQPNNFSGNQ-------------------HCVDLL-- 227
            .:.|...||.: :..:|:|.:|..| ||..|.  ||.|                   :||...  
  Rat   246 GVHDRRSEGLY-LFENGQRVSFFAWHRALSPE--SGAQPSAASHPLSPDQPNGGILENCVAQASD 307

  Fly   228 DGLMYDNKCESLSYFICQ 245
            ||..:|:.||...||:|:
  Rat   308 DGSWWDHDCERRLYFVCE 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 36/130 (28%)
Clec11aNP_001012477.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 58..111
CLECT 182..326 CDD:413318 40/150 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.