DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and Cd209a

DIOPT Version :10

Sequence 1:NP_608629.3 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001099374.1 Gene:Cd209a / 288375 RGDID:1308239 Length:240 Species:Rattus norvegicus


Alignment Length:122 Identity:37/122 - (30%)
Similarity:67/122 - (54%) Gaps:7/122 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 GSRFFYIEDETRRNWTSAGSACRQMGTQLATIRSAEELAALRAKLNKERHY-WLDITDLEKEGDF 195
            |:.:|:  ...:::|..:.:||..:|.||..|:|.||...|: |.:|:|.| |:.:.|:.||..:
  Rat   119 GNCYFF--SVAQKSWNDSATACHNVGAQLVVIKSEEEQNFLQ-KTSKKRGYTWMGLIDINKESTW 180

  Fly   196 R-ISASGKRPNFLK-WRAGQPNNFSGNQHCVDLLDGLMYDNKCESLSYFICQSDDDS 250
            . :..|.....|:| |..|:|||. |::.|.:..:....|.||::..::||:..:.|
  Rat   181 HWVDGSPLTLTFMKYWNKGEPNNV-GDKDCAEFREDGWNDTKCDNKKFWICKKPETS 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_608629.3 CLECT 141..245 CDD:153057 33/106 (31%)
Cd209aNP_001099374.1 CLECT_DC-SIGN_like 110..232 CDD:153060 36/116 (31%)

Return to query results.
Submit another query.