DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and Klra22

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_775413.2 Gene:Klra22 / 24933 RGDID:3023 Length:265 Species:Rattus norvegicus


Alignment Length:239 Identity:46/239 - (19%)
Similarity:89/239 - (37%) Gaps:69/239 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 FCLTALSPMLDHI-----ARHEGEWTSSVLQANATEARLARIETLQTAMNIRQKVLQEGFPKDIV 99
            |.|.:::.|:.:|     .:||.:.|.|.|..|        ..|:|..:|:::::|::       
  Rat    53 FRLVSVAVMVINIFQYSQEKHELQETLSNLHHN--------YSTMQNDINLKEEMLRD------- 102

  Fly   100 ARLDRLESQQAALLRILSKFDR---------KIVAPKFELIG------------SRFFYIEDETR 143
                 :.::.:|:...|...:|         |.|....:..|            ..:::|.|  |
  Rat   103 -----MSTEYSAVNHFLDFLNREKNRCYNKTKTVLDSSQHSGRGVEMHWFCYGIKCYYFIMD--R 160

  Fly   144 RNWTSAGSACRQMGTQLATIRSAEELAALRAKLNKERHYWLDITDLEKEGDFRISASGKRPNFLK 208
            :.|:.....|:.....|.||...:||..|...:..: .||:.::...|:.|:            .
  Rat   161 KTWSGCTQTCQNFSLPLLTIDDEDELMFLHLLVTPD-SYWIGLSYDNKKSDW------------T 212

  Fly   209 WRAGQPNNFSGNQHCVDLLDG-------LMYDN-KCESLSYFIC 244
            |....|:..:.|....::.||       ...|| .|::|...||
  Rat   213 WIDNNPSKLALNTRKYNIKDGGCVFLSKTRLDNINCDNLFSCIC 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 24/112 (21%)
Klra22NP_775413.2 Ly49 38..156 CDD:400616 20/122 (16%)
CLECT_NK_receptors_like 143..258 CDD:153063 26/129 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.