DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and Sftpa1

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001257574.1 Gene:Sftpa1 / 24773 RGDID:3665 Length:258 Species:Rattus norvegicus


Alignment Length:159 Identity:36/159 - (22%)
Similarity:67/159 - (42%) Gaps:15/159 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 GFP----KDIVARLDRLESQQAALLRILSKFDRKIVAPKFELIGSRFFYIEDETRRNWTSAGSAC 153
            |||    :::...|..::.|....:.:||      :......:|.:.|....:: .|:.:....|
  Rat   108 GFPAYLDEELQTELYEIKHQILQTMGVLS------LQGSMLSVGDKVFSTNGQS-VNFDTIKEMC 165

  Fly   154 RQMGTQLATIRSAEELAALRAKLNKERHY-WLDITDLEKEGDFRISASGKRPNFLKWRAGQPNNF 217
            .:.|..:|..|:.||..|:.:...|..:| :|.:.:.:..|||.. ..|...|:..|..|:|.. 
  Rat   166 TRAGGNIAVPRTPEENEAIASIAKKYNNYVYLGMIEDQTPGDFHY-LDGASVNYTNWYPGEPRG- 228

  Fly   218 SGNQHCVDL-LDGLMYDNKCESLSYFICQ 245
            .|.:.||:: .||...|..|......:|:
  Rat   229 QGKEKCVEMYTDGTWNDRGCLQYRLAVCE 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 26/105 (25%)
Sftpa1NP_001257574.1 Collagen 37..108 CDD:189968 36/159 (23%)
CLECT_collectin_like 146..258 CDD:153061 28/115 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5161
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.