DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and Colec10

DIOPT Version :10

Sequence 1:NP_608629.3 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_775598.2 Gene:Colec10 / 239447 MGIID:3606482 Length:277 Species:Mus musculus


Alignment Length:153 Identity:39/153 - (25%)
Similarity:75/153 - (49%) Gaps:9/153 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 KDIVARLDRLESQQAALLRILSKFDRKIVAPKFELIGSRFFYIEDETRRNWTSAGSACRQMGTQL 160
            :.:|.:||    ...|.|:...||.:.::|...| ...:|:||..| .:|:..:.:.||..|..|
Mouse   125 RKVVGQLD----ISVARLKTSMKFIKNVIAGIRE-TEEKFYYIVQE-EKNYRESLTHCRIRGGML 183

  Fly   161 ATIRSAEELAALRAKLNKERHY--WLDITDLEKEGDFRISASGKRPNFLKWRAGQPNNFSGNQHC 223
            |..:.......:...:.|...:  ::.:.|||:||.:..:.:....|:..|:..:|::.||::.|
Mouse   184 AMPKDEVVNTLIADYVAKSGFFRVFIGVNDLEREGQYVFTDNTPLQNYSNWKEEEPSDPSGHEDC 248

  Fly   224 VDLL-DGLMYDNKCESLSYFICQ 245
            |::| .|...|.:|....||:|:
Mouse   249 VEMLSSGRWNDTECHLTMYFVCE 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_608629.3 CLECT 141..245 CDD:153057 26/106 (25%)
Colec10NP_775598.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 41..103
gly_rich_SclB <46..>116 CDD:468478
CLECT_collectin_like 157..272 CDD:153061 30/116 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.