DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and FCER2

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001207429.1 Gene:FCER2 / 2208 HGNCID:3612 Length:321 Species:Homo sapiens


Alignment Length:267 Identity:56/267 - (20%)
Similarity:105/267 - (39%) Gaps:44/267 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SIW----LLLALFAWNAHAPSAAMPSVCLLQDAPQQCGEFCLTALSPMLDHIARHEGEWTSSVLQ 65
            ::|    .||.|:.|:.             ..:.:|..|.....:|.:..::..|.|:..:...|
Human    33 ALWAGLLTLLLLWHWDT-------------TQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQ 84

  Fly    66 A----------NATEARLARIETLQTAMNIR-----------QKVLQEGFPKDIVARLDRLESQQ 109
            :          .|.:.|| :.:.|:.:.|:.           |::.:.....|::.||....::.
Human    85 STQISQELEELRAEQQRL-KSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKL 148

  Fly   110 AALLRILSKFDRKIVAPKFELIGSRFFYIEDETRRNWTSAGSACRQMGTQLATIRSAEELAALRA 174
            ...|::.|.|.......|:.....:.:|....|:: |..|..||..|..||.:|.|.||...| .
Human   149 RMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQ-WVHARYACDDMEGQLVSIHSPEEQDFL-T 211

  Fly   175 KLNKERHYWLDITDLEKEGDFRISASGKRPNFLKWRAGQPNNFSGNQHCVDLL-DGLMYDNKCE- 237
            |.......|:.:.:|:.:|:| |...|...::..|..|:|.:.|..:.||.:. .|...|..|: 
Human   212 KHASHTGSWIGLRNLDLKGEF-IWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDR 275

  Fly   238 SLSYFIC 244
            .|..::|
Human   276 KLGAWVC 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 31/106 (29%)
FCER2NP_001207429.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 66..85 2/18 (11%)
Repetitive region 69..89 3/19 (16%)
RILP-like <77..153 CDD:304877 10/76 (13%)
Repetitive region 90..110 4/20 (20%)
Repetitive region 111..131 2/19 (11%)
CLECT 163..282 CDD:214480 32/121 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 290..321
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X73
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.