DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and Sftpd

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_033186.1 Gene:Sftpd / 20390 MGIID:109515 Length:374 Species:Mus musculus


Alignment Length:162 Identity:47/162 - (29%)
Similarity:79/162 - (48%) Gaps:12/162 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 QEGFPKDIVARLDRLESQQAALLRI---LSKFDRKIVAPKFELIGSRFFYIEDETRRNWTSAGSA 152
            :.|.| |..|...::|:.:..|.|:   .|.:.:..:.|....:|.:.|...| :.:.:..|...
Mouse   217 ESGLP-DSAALRQQMEALKGKLQRLEVAFSHYQKAALFPDGRSVGDKIFRTAD-SEKPFEDAQEM 279

  Fly   153 CRQMGTQLATIRSAEELAALRAKL---NKERHYWLDITDLEKEGDFRISASGKRPNFLKWRAGQP 214
            |:|.|.|||:.|||.|.||::..:   ||..  :|.:||:..||.|.. .:|:...:..|..|:|
Mouse   280 CKQAGGQLASPRSATENAAIQQLITAHNKAA--FLSMTDVGTEGKFTY-PTGEPLVYSNWAPGEP 341

  Fly   215 NNFSGNQHCVDLL-DGLMYDNKCESLSYFICQ 245
            ||..|.::||::. :|...|..|......||:
Mouse   342 NNNGGAENCVEIFTNGQWNDKACGEQRLVICE 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 34/107 (32%)
SftpdNP_033186.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 38..222 2/5 (40%)
Collagen 45..102 CDD:189968
Collagen 129..>171 CDD:189968
Surfac_D-trimer 223..267 CDD:286141 8/43 (19%)
CLECT_collectin_like 261..374 CDD:153061 37/117 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I5263
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.