DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and Sftpa1

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_075623.2 Gene:Sftpa1 / 20387 MGIID:109518 Length:248 Species:Mus musculus


Alignment Length:173 Identity:42/173 - (24%)
Similarity:70/173 - (40%) Gaps:34/173 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 ETLQTAM-NIRQKVLQE-GFPKDIVARLDRLESQQAALLRILSKFDRKIVAPKFELIGSRFFYIE 139
            |.||||: .|:.::||. |           :.|.|.::|.                :|.:.|...
Mouse   105 EELQTALYEIKHQILQTMG-----------VLSLQGSMLS----------------VGDKVFSTN 142

  Fly   140 DETRRNWTSAGSACRQMGTQLATIRSAEELAALRAKLNKERHY-WLDITDLEKEGDFRISASGKR 203
            .:: .|:.:....|.:.|..:|..|:.||..|:.:...|...| :|.:.:.:..|||.. ..|..
Mouse   143 GQS-VNFDTIREMCTRAGGHIAAPRNPEENEAIASITKKYNTYPYLGVIEGQTPGDFHY-LDGAS 205

  Fly   204 PNFLKWRAGQPNNFSGNQHCVDL-LDGLMYDNKCESLSYFICQ 245
            .|:..|..|:|.. .|.:.||:: .||...|..|......||:
Mouse   206 VNYTNWYPGEPRG-RGKEKCVEMYTDGKWNDKGCLQYRLAICE 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 27/105 (26%)
Sftpa1NP_075623.2 Collagen 27..98 CDD:189968
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 28..100
CLECT_collectin_like 136..248 CDD:153061 29/115 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I5263
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.