DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and clec-38

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_507233.2 Gene:clec-38 / 188900 WormBaseID:WBGene00012025 Length:382 Species:Caenorhabditis elegans


Alignment Length:222 Identity:44/222 - (19%)
Similarity:77/222 - (34%) Gaps:38/222 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 MLDHIARHEGEWTSSVLQANATEARLARIETLQTAMNIRQKVLQEGFPKDIVA----------RL 102
            |||.:.....::..:.|..|.| ||.:.|..:::..........:|||..:..          ..
 Worm   170 MLDFVKDSNIDFLWTGLVCNQT-ARTSCIWDVKSGTTADYNNFADGFPNVVYGYCIYFIVTGNSA 233

  Fly   103 DRLESQQAA-LLRILSKFDRKIVAPKFELIGSRFFYIEDETRRNWTSAGSACRQMGTQLATIRSA 166
            .:..|:|.: |:..:.:....|..|..:...::..||..:.......|...|.:.|..|.:|.||
 Worm   234 GQWGSEQCSQLMNFVCELPTTIRDPDCKYNYNKNCYIRFDITLTIPQAQRFCNEKGADLVSIHSA 298

  Fly   167 EELAALRAKLNKERHYWLDITDLEKEGDFRISASGKRPNFLKWRAGQPNNFSG------NQHCVD 225
                       .|..:.|.|.|:  .|...:.......:|:.|..|.|..:|.      .:.||.
 Worm   299 -----------NENRFILTIYDI--HGQILLGGLAPAVDFIVWLDGSPTTYSNLLYFYDTRSCVL 350

  Fly   226 L-------LDGLMYDNKCESLSYFICQ 245
            :       .||..|...|....:|:|:
 Worm   351 MTVARGGPYDGDWYTMNCNVQEFFLCK 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 24/116 (21%)
clec-38NP_507233.2 CLECT 122..250 CDD:214480 15/80 (19%)
CLECT 264..377 CDD:214480 26/125 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.