DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and clec-149

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_497267.2 Gene:clec-149 / 186903 WormBaseID:WBGene00019328 Length:308 Species:Caenorhabditis elegans


Alignment Length:193 Identity:48/193 - (24%)
Similarity:91/193 - (47%) Gaps:14/193 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 HEGEWTSSVLQANATEARL-ARIETLQTAMNIRQKVLQEGFPKDIVARLDRLESQQAALLRILSK 118
            |:.|...:.......|.:: |:.||.:...::|::     |..|: ...:|:.::.  ::.|...
 Worm   125 HDIEALEAKFDKKLYEVKMHAQYETEKGVGDLRKQ-----FETDL-REYERITTKD--IVEIKRH 181

  Fly   119 FDRKIVAPKFELIGSRFFYIEDETRRNWTSAGSACRQMGTQLATIRSAEELAALRAKLNKERHYW 183
            .| .:.||:.......:|:|:.|  .:|.:|...|...|..||:|.|..||..::..:...:..|
 Worm   182 LD-YLQAPRITNNDLEYFFIQRE--ESWYTASEKCIGYGAHLASIHSRLELGFVQRLVPVNQTAW 243

  Fly   184 LDITDLEKEGDFRISASGKRPNFLKWRAGQPNNFSGNQHCVDL-LDGLMYDNKCESLSYFICQ 245
            :.:.|::||..|| ::.|...:|.||...||:|...|::||:: ..|...|..|.....|:|:
 Worm   244 IGVNDIQKENVFR-NSDGTPVDFYKWGKKQPDNQEHNENCVEVDHSGQWTDKLCIITRPFVCK 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 31/104 (30%)
clec-149NP_497267.2 CLECT 197..306 CDD:153057 34/112 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4072
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.060

Return to query results.
Submit another query.