DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and clec-148

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_497168.1 Gene:clec-148 / 185558 WormBaseID:WBGene00018246 Length:188 Species:Caenorhabditis elegans


Alignment Length:103 Identity:28/103 - (27%)
Similarity:41/103 - (39%) Gaps:34/103 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 SRFFYIEDETRRNWTSAGSACRQMGTQLATIRSAEE------LAALRAKLNKERHY--------- 182
            :.|.|.......|:..|.:|||..|::||:|.|..|      |:|...::|.:.:|         
 Worm    58 TNFCYKSTARAANFNDAHNACRSEGSELASIHSLTENQFLVQLSAAGNRVNSKTNYVMIGLIFEN 122

  Fly   183 ----WLDITDLEKEGDFRISASGKRPNFLKWRAGQPNN 216
                |.|               |...|:|.|.||:|||
 Worm   123 REWSWTD---------------GSSVNYLNWAAGEPNN 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 26/95 (27%)
clec-148NP_497168.1 CLECT 60..184 CDD:153057 28/101 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7163
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X73
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.950

Return to query results.
Submit another query.