DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and clec-7

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_504865.1 Gene:clec-7 / 184314 WormBaseID:WBGene00017364 Length:417 Species:Caenorhabditis elegans


Alignment Length:129 Identity:29/129 - (22%)
Similarity:41/129 - (31%) Gaps:37/129 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 FYIEDETRRNWTSAGSACRQMGTQLATIRSAEELAALRAKLNKERHYWLDITDLEKEGDFRISAS 200
            :|.|    .::..|.:.|.|....||||.:|.|   .|..|...:||       ......||.|:
 Worm   172 YYAE----ASFVVAQNTCEQFCGDLATIHTANE---NRYILTVAQHY-------PSSTIVRIGAT 222

  Fly   201 GKRPNFLKWRAGQPNNFSGNQHCVDLLD-------------------GLMYDNKCESLSYFICQ 245
            ....|..:|..|.|..:..    :||..                   |..:...|.....|||:
 Worm   223 WPASNVYQWVDGLPWEYKN----IDLTGPRGGDCMVMSTRPPSPVAAGYWFGASCTDERNFICK 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 26/122 (21%)
clec-7NP_504865.1 CLECT 25..152 CDD:214480
CLECT 165..282 CDD:214480 28/127 (22%)
CUB 308..412 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.