DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and clec-86

DIOPT Version :10

Sequence 1:NP_608629.3 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_509202.1 Gene:clec-86 / 183775 WormBaseID:WBGene00016912 Length:166 Species:Caenorhabditis elegans


Alignment Length:107 Identity:25/107 - (23%)
Similarity:42/107 - (39%) Gaps:27/107 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 RQMGTQLATIRSAEELAALRAKLNKERHYW---LDITDLEKEGD-FRISASGK-RPNFLKWRAGQ 213
            :.:|..|.:|.|..|            :.|   |.:.:|:.:.| |.|..|.: ..|..:|..|.
 Worm    50 KTVGGSLVSIHSMIE------------NNWIQKLAVDNLDADYDLFWIGGSDEGHTNDWRWTDGS 102

  Fly   214 PNNFSG--------NQHC--VDLLDGLMYDNKCESLSYFICQ 245
            ..||:.        ::||  :.|..|..:.:.|.....|:||
 Worm   103 VLNFTNPGPGQPLEDRHCGAMQLSTGRWFSDLCTVKHQFLCQ 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_608629.3 CLECT 141..245 CDD:153057 23/105 (22%)
clec-86NP_509202.1 CLECT 20..144 CDD:214480 23/105 (22%)

Return to query results.
Submit another query.