DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and clec-198

DIOPT Version :10

Sequence 1:NP_608629.3 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_503091.3 Gene:clec-198 / 183598 WormBaseID:WBGene00008203 Length:499 Species:Caenorhabditis elegans


Alignment Length:102 Identity:20/102 - (19%)
Similarity:37/102 - (36%) Gaps:36/102 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 WTSAGSAC--RQMGTQLATIRS---AEELAA----------------LRAKLNKERHYWLDITDL 189
            |.:|...|  ::.|:.|.::.|   |:.:||                ||...:...:.|.|.|.:
 Worm   108 WYAAEDWCYSQRYGSHLTSVHSEAEAQWIAATYVSTGWFPYMDNWLGLRRSCDNSTYIWTDGTPV 172

  Fly   190 EKEGDFRISASGKRPNFLKWRAGQPNNFSGNQHCVDL 226
            :               :|.|:.|.|.:....:.||.:
 Worm   173 D---------------YLWWQPGYPGSGDPEKSCVTI 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_608629.3 CLECT 141..245 CDD:153057 20/102 (20%)
clec-198NP_503091.3 CLECT 85..198 CDD:214480 20/102 (20%)
CLECT 371..497 CDD:214480
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.