DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and clec-50

DIOPT Version :10

Sequence 1:NP_608629.3 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_507830.1 Gene:clec-50 / 180299 WormBaseID:WBGene00012253 Length:321 Species:Caenorhabditis elegans


Alignment Length:109 Identity:28/109 - (25%)
Similarity:48/109 - (44%) Gaps:11/109 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 WTSAGSACRQMGTQLATIRSAEE------LAALRAKL-NKERHYWLDITDLEKEGDFRISASGKR 203
            |..|.:||..:|..|.::.|..|      ||:...|. |.:...|:   .:.|.|...:...|..
 Worm   204 WEDAEAACVLLGAHLTSVHSETENTFVANLASCGIKEGNPKDLAWI---GMHKVGQDWVWTDGTP 265

  Fly   204 PNFLKWRAGQPNNFSGNQHCVDLLDGLMYDNKCESLSYFICQSD 247
            .|::.|...||:| .|.::||:....|.:|...|:.:...|.::
 Worm   266 SNYINWAPKQPDN-PGKENCVETAPDLSHDKWYENWNNEACSTE 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_608629.3 CLECT 141..245 CDD:153057 27/105 (26%)
clec-50NP_507830.1 CLECT 26..146 CDD:214480
CLECT 182..315 CDD:214480 28/109 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.