DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and clec-49

DIOPT Version :10

Sequence 1:NP_608629.3 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_507829.1 Gene:clec-49 / 180298 WormBaseID:WBGene00012251 Length:321 Species:Caenorhabditis elegans


Alignment Length:103 Identity:27/103 - (26%)
Similarity:48/103 - (46%) Gaps:9/103 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 AGSACRQMGTQLATIRSAEELAALRA------KLNKERHYWLDITDLEKEGDFRISASGKRPNFL 207
            |...|..:|..||::::.:|.|.|::      |.:....||:..||||..|.::.:......::.
 Worm    46 AEQQCNLLGGHLASVQNGQENALLQSNAANSFKRSNYSDYWIGATDLETSGTWKWTDPSVTFDYS 110

  Fly   208 KWRAGQPNNFSGNQHCV-DLLDGLMYDNKCESLSYFIC 244
            .|:.|:|.  ||:...: |..||......|.|...::|
 Worm   111 NWQLGEPQ--SGSDCAIQDKGDGTWSAIGCTSYRPYVC 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_608629.3 CLECT 141..245 CDD:153057 27/103 (26%)
clec-49NP_507829.1 CLECT 31..146 CDD:214480 26/101 (26%)
CLECT 182..315 CDD:214480
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.