DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and Clec4d

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_034949.3 Gene:Clec4d / 17474 MGIID:1298389 Length:219 Species:Mus musculus


Alignment Length:94 Identity:24/94 - (25%)
Similarity:44/94 - (46%) Gaps:4/94 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 FFYIEDETRRNWTSAGSACRQMGTQLATIRSAEELAALRAKLNKERHYWLDITDLEKEGDFR-IS 198
            :|.:.|  .:.|..:...|..|.:.|.||.:..|...:...|:|...|:|.:.|...||.:: :.
Mouse    95 YFPLND--NQTWHESERNCSGMSSHLVTINTEAEQNFVTQLLDKRFSYFLGLADENVEGQWQWVD 157

  Fly   199 ASGKRPNFLKWRAGQPNNFSGNQHCVDLL 227
            .:...|:.:.|..|:.|:|. .:.||.|:
Mouse   158 KTPFNPHTVFWEKGESNDFM-EEDCVVLV 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 22/88 (25%)
Clec4dNP_034949.3 CLECT_DC-SIGN_like 83..207 CDD:153060 24/94 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X73
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.