DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and clec-53

DIOPT Version :10

Sequence 1:NP_608629.3 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_491247.2 Gene:clec-53 / 171967 WormBaseID:WBGene00020191 Length:308 Species:Caenorhabditis elegans


Alignment Length:83 Identity:24/83 - (28%)
Similarity:40/83 - (48%) Gaps:12/83 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 NWTSAGSACRQMGTQLATIRSAEELAAL----RAKL-NKERHY----WLDITDLEKEGDFRISAS 200
            |:..|.|||:..|..||:|.|..|.|.|    :|.: ||::.:    |:.:.....:..:   ..
 Worm   188 NFNDARSACQADGGDLASIHSIAENAFLVGLSKAGITNKDKDWNDDVWIGLVYQNSKWQW---TD 249

  Fly   201 GKRPNFLKWRAGQPNNFS 218
            |...|::.|..|:|||.:
 Worm   250 GSVVNYVNWGDGEPNNMN 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_608629.3 CLECT 141..245 CDD:153057 24/83 (29%)
clec-53NP_491247.2 CLECT 32..147 CDD:153057
CLECT 166..303 CDD:214480 24/83 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.