DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and Mbl2

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001351987.1 Gene:Mbl2 / 17195 MGIID:96924 Length:244 Species:Mus musculus


Alignment Length:145 Identity:42/145 - (28%)
Similarity:70/145 - (48%) Gaps:5/145 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 LESQQAALLRILSKFDRKIVAPKFELIGSRFFYIEDETRRNWTSAGSACRQMGTQLATIRSAEEL 169
            ::|:.|||...|......::....|.:|.::| :....:.:.....:.|.:....:||.|:|||.
Mouse   104 IDSEIAALRSELRALRNWVLFSLSEKVGKKYF-VSSVKKMSLDRVKALCSEFQGSVATPRNAEEN 167

  Fly   170 AALRAKLNKERHYWLDITDLEKEGDFRISASGKRPNFLKWRAGQPNNFSGNQHCVDLL-DGLMYD 233
            :|:: |:.|:..| |.|||:..||.|. ..:|.|..:..|..|:|||....:.||.:| :|...|
Mouse   168 SAIQ-KVAKDIAY-LGITDVRVEGSFE-DLTGNRVRYTNWNDGEPNNTGDGEDCVVILGNGKWND 229

  Fly   234 NKCESLSYFICQSDD 248
            ..|......||:..|
Mouse   230 VPCSDSFLAICEFSD 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 32/104 (31%)
Mbl2NP_001351987.1 Collagen 36..93 CDD:189968
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..101
CLECT 132..242 CDD:382969 34/113 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I5263
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.