DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and Mbl1

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_034905.1 Gene:Mbl1 / 17194 MGIID:96923 Length:239 Species:Mus musculus


Alignment Length:158 Identity:40/158 - (25%)
Similarity:73/158 - (46%) Gaps:6/158 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 QEGFPKDIVARLDRLESQQAALLRILSKFD--RKIVAPKFELIGSRFFYIEDETRRNWTSAGSAC 153
            |:|...|..|..::|.:.:|.:..:.||..  .|:.|........:..::.:..:..::...|.|
Mouse    82 QKGDHGDNRAIEEKLANMEAEIRILKSKLQLTNKLHAFSMGKKSGKKLFVTNHEKMPFSKVKSLC 146

  Fly   154 RQMGTQLATIRSAEELAALRAKLNKERHYWLDITDLEKEGDFRISASGKRPNFLKWRAGQPNNFS 218
            .::...:|..|:|||..|::.......  :|.|||...||.| :..:|.|..:..|:..:|||..
Mouse   147 TELQGTVAIPRNAEENKAIQEVATGIA--FLGITDEATEGQF-MYVTGGRLTYSNWKKDEPNNHG 208

  Fly   219 GNQHCVDLLD-GLMYDNKCESLSYFICQ 245
            ..:.||.:|| ||..|..|::....:|:
Mouse   209 SGEDCVIILDNGLWNDISCQASFKAVCE 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 29/104 (28%)
Mbl1NP_034905.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 35..88 2/5 (40%)
Collagen <37..89 CDD:189968 2/6 (33%)
CLECT_collectin_like 127..237 CDD:153061 30/113 (27%)
Calcium-dependent carbohydrate binding. /evidence=ECO:0000250|UniProtKB:P19999 203..211 3/7 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I5263
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.