DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and Fcer2

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001029096.1 Gene:Fcer2 / 171075 RGDID:619997 Length:331 Species:Rattus norvegicus


Alignment Length:223 Identity:56/223 - (25%)
Similarity:92/223 - (41%) Gaps:28/223 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LSPMLDHIARHEGEWTS--SVLQANATEAR--LARIETLQTAMNIRQKVLQEGFPKDIV------ 99
            :|..|:.:...:.:..|  |.|..|..|.:  |..:::..:.::.....|||    |:|      
  Rat    90 MSQNLEELQAEQKQMKSQDSQLSQNLNELQEDLINVKSQNSELSQNLNTLQE----DLVNVKSQG 150

  Fly   100 -----ARLDRLESQQAALLR-----ILSKFDRKIVAPKFELIGSRFFYIEDETRRNWTSAGSACR 154
                 |..|.||..|..:.:     ::||.....|.||..|...:..|...|..:.|..|...|.
  Rat   151 LNEKRAASDSLEKLQEEVAKLWIEILMSKGTACNVCPKDWLHFQQKCYYFGEGSKQWIQAKFTCS 215

  Fly   155 QMGTQLATIRSAEELAALRAKLNKERHYWLDITDLEKEGDFRISASGKRPNFLKWRAGQPNNFSG 219
            .:..:|.:|.|.:|...|...:|| :..|:.:.||..||:| :...|....:..|..|:|||...
  Rat   216 DLEGRLVSIHSQKEQDFLMQHINK-KESWIGLQDLNMEGEF-VWPDGSPVGYSNWSPGEPNNGGQ 278

  Fly   220 NQHCVDLL-DGLMYDNKCES-LSYFICQ 245
            .:.||.:. .|...|..|.| |..::|:
  Rat   279 GEDCVMMRGSGQWNDAFCRSYLDAWVCE 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 30/105 (29%)
Fcer2NP_001029096.1 RILP-like <60..170 CDD:304877 18/83 (22%)
CLECT_DC-SIGN_like 186..306 CDD:153060 34/121 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X73
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.