DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and Cd209c

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:XP_017168078.1 Gene:Cd209c / 170776 MGIID:2157945 Length:240 Species:Mus musculus


Alignment Length:216 Identity:53/216 - (24%)
Similarity:99/216 - (45%) Gaps:53/216 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 FCLT-------ALSPMLDHIARHEGEWTSSVLQANATEARLARIETLQTAMNIRQKVLQEGFPKD 97
            ||||       |:...:.::|...|:          .:|:             ::||.:|     
Mouse    59 FCLTLSTILLLAILVKVSNVAYSHGQ----------EQAK-------------KEKVYKE----- 95

  Fly    98 IVARLDRLESQQAALLRILSKFDRKIVAPKFELIGSRFFYIEDETRRNWTSAGSACRQMGTQLAT 162
                :.:|:||...|.| ...:|..:    |:  |:.:|:  .:.::||..:.:|||::..||..
Mouse    96 ----MTQLKSQINRLCR-PCPWDWTV----FQ--GNCYFF--SKFQQNWNDSVNACRKLDAQLVV 147

  Fly   163 IRSAEELAALRAKLNKERHY-WLDITDLEKEGDFR-ISASGKRPNFLK-WRAGQPNNFSGNQHCV 224
            |:|.:|.:.|: :.:||:.| |:.::||:.||.:. :..|....:|:| |..|:||| ...:.|.
Mouse   148 IKSDDEQSFLQ-QTSKEKGYAWMGLSDLKHEGRWHWVDGSHLLFSFMKYWNKGEPNN-EWEEDCA 210

  Fly   225 DLLDGLMYDNKCESLSYFICQ 245
            :.......|..|....|:||:
Mouse   211 EFRGDGWNDAPCTIKKYWICK 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 32/106 (30%)
Cd209cXP_017168078.1 CLECT_DC-SIGN_like 110..232 CDD:153060 37/132 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 77 1.000 Domainoid score I8813
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.