DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and Klra17

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001368891.1 Gene:Klra17 / 170733 MGIID:2180674 Length:274 Species:Mus musculus


Alignment Length:185 Identity:35/185 - (18%)
Similarity:68/185 - (36%) Gaps:32/185 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 TLQTAMNIRQKVLQEGFPKDIVARLDRLESQQAALLRILSKFDRKIVAPK-----FEL----IGS 133
            |:|..:|.::::|: ..|.:.....|.|:|......|..|:....:.:.|     .|:    .|.
Mouse    91 TMQNDINAKEEMLR-NMPLECSTGDDLLKSLNREQKRWYSETKSVLNSSKHPGGSLEIHWFCYGI 154

  Fly   134 RFFYIEDETRRNWTSAGSACRQMGTQLATIRSAEELAALRAKLNKERHYWLDITDLEKEGDFRIS 198
            :.:|. ...::.|......|......|..|.:.:||..|:.::..: .||:..            
Mouse   155 KCYYF-IMNKKGWRKCKQICEHYSLSLLKIDAEDELKFLQLQVTPD-SYWIGF------------ 205

  Fly   199 ASGKRPNFLKWRAGQPNNFSGNQ--------HCVDLLDGLMYDNKCESLSYFICQ 245
            :..|:.....|.....:.::.|.        .||.|....:.:||||.:...||:
Mouse   206 SFDKKSEKWTWIENGTSKYALNMSTYNVKSGECVFLSKTRLENNKCEHVYPCICE 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 20/111 (18%)
Klra17NP_001368891.1 Ly49 41..159 CDD:400616 13/68 (19%)
CLECT_NK_receptors_like 146..261 CDD:153063 24/129 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.