DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and Klra10

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_032485.2 Gene:Klra10 / 16628 MGIID:1321093 Length:266 Species:Mus musculus


Alignment Length:115 Identity:26/115 - (22%)
Similarity:49/115 - (42%) Gaps:17/115 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 FFYIEDETRRNWTSAGSACRQMGTQLATIRSAEELAALRAKLNKERH-----YWLDITDLEKEGD 194
            :::|.::|  .|:...:.|:.....:..|...:||..|      :||     ||:.::..:|:.:
Mouse   155 YYFIMNKT--TWSGCKANCQHYSVPIVKIEDEDELKFL------QRHVIPESYWIGLSYDKKKKE 211

  Fly   195 FRISASGKRPNFLKWRAGQPNNFSGNQHCVDLLDGLMYDNKCESLSYFIC 244
            :....:|.....:|.|   ..||. ::.||.|....:.|..|....|.||
Mouse   212 WAWIDNGPSKLDMKIR---KMNFK-SRGCVFLSKARIEDTDCNIPYYCIC 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 25/109 (23%)
Klra10NP_032485.2 Ly49 40..157 CDD:369850 0/1 (0%)
CLECT_NK_receptors_like 145..257 CDD:153063 24/113 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.