DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and Fcer2a

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:XP_006508760.1 Gene:Fcer2a / 14128 MGIID:95497 Length:335 Species:Mus musculus


Alignment Length:206 Identity:54/206 - (26%)
Similarity:89/206 - (43%) Gaps:27/206 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 QANATEARLAR-----IETLQTAMNIRQKVLQ--EGFPKDIV--------------ARLDRLESQ 108
            |..|.::||::     .|.|:.|.:...|:.|  .....|:|              ..|::|:.:
Mouse   107 QMKAQDSRLSQNLTGLQEDLRNAQSQNSKLSQNLNRLQDDLVNIKSLGLNEKRTASDSLEKLQEE 171

  Fly   109 QAAL-LRIL-SKFDRKIVAPKFELIGSRFFYIEDETRRNWTSAGSACRQMGTQLATIRSAEELAA 171
            .|.| :.|| ||.....:.||..|...:..|...:..:.|..|..||..:..:|.:|.|.:|...
Mouse   172 VAKLWIEILISKGTACNICPKNWLHFQQKCYYFGKGSKQWIQARFACSDLQGRLVSIHSQKEQDF 236

  Fly   172 LRAKLNKERHYWLDITDLEKEGDFRISASGKRPNFLKWRAGQPNNFSGNQHCVDLL-DGLMYDNK 235
            |...:|| :..|:.:.||..||:| :.:.|....:..|..|:|||....:.||.:. .|...|..
Mouse   237 LMQHINK-KDSWIGLQDLNMEGEF-VWSDGSPVGYSNWNPGEPNNGGQGEDCVMMRGSGQWNDAF 299

  Fly   236 CES-LSYFICQ 245
            |.| |..::|:
Mouse   300 CRSYLDAWVCE 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 30/105 (29%)
Fcer2aXP_006508760.1 SH3_and_anchor <77..>175 CDD:275056 14/67 (21%)
CLECT_DC-SIGN_like 190..310 CDD:153060 34/121 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.