DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and Colec12

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_569716.2 Gene:Colec12 / 140792 MGIID:2152907 Length:742 Species:Mus musculus


Alignment Length:126 Identity:33/126 - (26%)
Similarity:63/126 - (50%) Gaps:17/126 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 FFYIEDETRRNWTSAGSACRQMGTQLATIRSAEELAALRAKLNKERHYWLDITDLEKEGDFRISA 199
            :|.:|.|.   :..|...|....:.|..|.|.||...::........:|:.:||.|:|.::: ..
Mouse   620 YFSLEKEI---FEDAKLFCEDKSSHLVFINSREEQQWIKKHTVGRESHWIGLTDSEQESEWK-WL 680

  Fly   200 SGKRPNFLKWRAGQPNNF-SGN---QHCVDLLDGLMY-----DNKCESLSYFICQSDDDSL 251
            .|...::..|:||||:|: ||:   :.|.    ||:|     |.:|:.::.|||:.:.:::
Mouse   681 DGSPVDYKNWKAGQPDNWGSGHGPGEDCA----GLIYAGQWNDFQCDEINNFICEKEREAV 737

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 30/112 (27%)
Colec12NP_569716.2 CwlO1 48..280 CDD:226400
VirB5_like 157..317 CDD:295212
Fimbrial <286..359 CDD:294848
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 439..608
Collagen 454..563 CDD:189968
CLECT_DC-SIGN_like 607..732 CDD:153060 33/119 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.