DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and CG43055

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001245867.1 Gene:CG43055 / 12798556 FlyBaseID:FBgn0262357 Length:180 Species:Drosophila melanogaster


Alignment Length:132 Identity:39/132 - (29%)
Similarity:59/132 - (44%) Gaps:12/132 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 APKFELIGSRFFYIEDETRRNWTSAGSACRQMGTQLATIRSAEELAALRAKL---NKERHYWLDI 186
            || |..||..:::||::..|||..|..|||||...|......:|...:...|   ..:..||...
  Fly    40 AP-FVKIGDSYYFIENKLDRNWYDAFEACRQMNADLVAFEDRKEQKLIYHYLVDNEMDTTYWTAG 103

  Fly   187 TDLEKEGDFRISASGKRPNFLKWRAGQPNNFSGNQHCVDLLD-------GLMYDNKCESLSYFIC 244
            |||.::..|...::|:......|...:|||....:|||:...       || .|..|...:.:||
  Fly   104 TDLAEQDSFVWFSNGQPVASDLWCNNEPNNAKNEEHCVEYKPLHPEAKMGL-NDRVCTFKTGYIC 167

  Fly   245 QS 246
            ::
  Fly   168 RA 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 31/113 (27%)
CG43055NP_001245867.1 CLECT 49..167 CDD:153057 32/118 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X73
44.020

Return to query results.
Submit another query.