DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and Asgr2

DIOPT Version :10

Sequence 1:NP_608629.3 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_031519.1 Gene:Asgr2 / 11890 MGIID:88082 Length:301 Species:Mus musculus


Alignment Length:124 Identity:33/124 - (26%)
Similarity:60/124 - (48%) Gaps:12/124 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 ELIGSRFFYIEDETRRNWTSAGSACRQMGTQLATIRSAEELAALRAKLNKERHYWLDITDLEKEG 193
            |..||.:::..|..  .|..|...|:.....|..|.|.||...: .|...:.|.|:.:||  ::|
Mouse   176 EFGGSCYWFSRDGL--TWAEADQYCQLENAHLLVINSREEQDFV-VKHRSQFHIWIGLTD--RDG 235

  Fly   194 DFR-ISASGKRPNFLKWRAGQPNNFSGNQH-----CVDLL-DGLMYDNKCESLSYFICQ 245
            .:: :..:..|.|:..|...||:|:.|::.     |.::| ||...||.|:.::.::|:
Mouse   236 SWKWVDGTDYRSNYRNWAFTQPDNWQGHEQGGGEDCAEILSDGHWNDNFCQQVNRWVCE 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_608629.3 CLECT 141..245 CDD:153057 28/110 (25%)
Asgr2NP_031519.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43
Lectin_N 4..162 CDD:461106
CLECT_DC-SIGN_like 170..295 CDD:153060 33/124 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.