DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and Asgr1

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001278060.1 Gene:Asgr1 / 11889 MGIID:88081 Length:284 Species:Mus musculus


Alignment Length:268 Identity:56/268 - (20%)
Similarity:103/268 - (38%) Gaps:55/268 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LSIWLLLALFAWNAHAPSAAMPSVCLLQDAPQQCGEFCLTALSPMLDHIARHEGEWTSSVLQANA 68
            |||.||:.               ||::.....|..| .|.||.....::.....:...::....:
Mouse    47 LSILLLVV---------------VCVITSQNSQLRE-DLLALRQNFSNLTVSTEDQVKALSTQGS 95

  Fly    69 TEARLARIETLQTAMNIRQKVLQEGFP------KDIVARLDRLESQQAALLRILSKFDRKIVAP- 126
            :..|  :::.:::.:..:||.|.|...      |.:|:.:..|..|.||   .......:...| 
Mouse    96 SVGR--KMKLVESKLEKQQKDLTEDHSSLLLHVKQLVSDVRSLSCQMAA---FRGNGSERTCCPI 155

  Fly   127 ---KFELIGSRFFYIEDETRRNWTSAGSACRQMGTQLATIRSAEELAALRAKLNKERHY-----W 183
               ::|  ||.:::  ..:.|.||.|...|:.....|..:.|.:|...|      :||.     |
Mouse   156 NWVEYE--GSCYWF--SSSVRPWTEADKYCQLENAHLVVVTSRDEQNFL------QRHMGPLNTW 210

  Fly   184 LDITDLEKEGDFR-ISASGKRPNFLKWRAGQPNNF-----SGNQHCVDL-LDGLMYDNKCESLSY 241
            :.:||  :.|.:: :..:.....|..||..||:|:     .|.:.|... .||...|:.|.....
Mouse   211 IGLTD--QNGPWKWVDGTDYETGFQNWRPEQPDNWYGHGLGGGEDCAHFTTDGRWNDDVCRRPYR 273

  Fly   242 FICQSDDD 249
            ::|::..|
Mouse   274 WVCETKLD 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 27/115 (23%)
Asgr1NP_001278060.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
Endocytosis signal. /evidence=ECO:0000255 5..8
Lectin_N 15..143 CDD:397859 23/116 (20%)
CLECT_DC-SIGN_like 153..278 CDD:153060 32/136 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.