DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and COLEC10

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_006429.2 Gene:COLEC10 / 10584 HGNCID:2220 Length:277 Species:Homo sapiens


Alignment Length:153 Identity:41/153 - (26%)
Similarity:74/153 - (48%) Gaps:9/153 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 KDIVARLDRLESQQAALLRILSKFDRKIVAPKFELIGSRFFYIEDETRRNWTSAGSACRQMGTQL 160
            :..|.:||    ...|.|:...||.:.::|...| ...:|:||..| .:|:..:.:.||..|..|
Human   125 RKFVGQLD----ISIARLKTSMKFVKNVIAGIRE-TEEKFYYIVQE-EKNYRESLTHCRIRGGML 183

  Fly   161 ATIR--SAEELAALRAKLNKERHYWLDITDLEKEGDFRISASGKRPNFLKWRAGQPNNFSGNQHC 223
            |..:  :|..|.|.....:.....::.:.|||:||.:..:.:....|:..|..|:|::..|::.|
Human   184 AMPKDEAANTLIADYVAKSGFFRVFIGVNDLEREGQYMFTDNTPLQNYSNWNEGEPSDPYGHEDC 248

  Fly   224 VDLL-DGLMYDNKCESLSYFICQ 245
            |::| .|...|.:|....||:|:
Human   249 VEMLSSGRWNDTECHLTMYFVCE 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 28/106 (26%)
COLEC10NP_006429.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..107
Collagen 45..111 CDD:189968
CLECT_collectin_like 157..272 CDD:153061 32/116 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I5300
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.