DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and CLEC10A

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:XP_011521915.1 Gene:CLEC10A / 10462 HGNCID:16916 Length:319 Species:Homo sapiens


Alignment Length:109 Identity:25/109 - (22%)
Similarity:50/109 - (45%) Gaps:10/109 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 NWTSAGSACRQMGTQLATIRSAEELAALRAKLNKERHYWLDITDLEKEGDFR-ISASGKRPNFLK 208
            :|..|...|:.....|..|.|.||...::..|. ..:.|:.::|  .||.:: :..:.....|..
Human   204 SWAEAEKYCQLKNAHLVVINSREEQNFVQKYLG-SAYTWMGLSD--PEGAWKWVDGTDYATGFQN 265

  Fly   209 WRAGQPNNFSGN-----QHCVDL-LDGLMYDNKCESLSYFICQS 246
            |:.|||:::.|:     :.|... .||...|:.|:...:::|::
Human   266 WKPGQPDDWQGHGLGGGEDCAHFHPDGRWNDDVCQRPYHWVCEA 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 24/106 (23%)
CLEC10AXP_011521915.1 Lectin_N 18..170 CDD:281887
CLECT_DC-SIGN_like 184..308 CDD:153060 24/106 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.