DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and si:ch73-111e15.1

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:XP_005172686.1 Gene:si:ch73-111e15.1 / 101885260 ZFINID:ZDB-GENE-110411-28 Length:271 Species:Danio rerio


Alignment Length:236 Identity:47/236 - (19%)
Similarity:102/236 - (43%) Gaps:49/236 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 IARHEGEWTSSVLQ------ANATEARLAR------------IETLQTAMNIRQKVLQEGFPKD- 97
            :..|:....|:..|      :|..:.|.:|            :.|...|:::.....|..:|:: 
Zfish    35 VGNHDYRTNSNTQQPPQNTGSNPVKTRSSRAALVCLVLLCFLLLTAVIALSVYIYTNQPNYPEER 99

  Fly    98 --IVARLDRLESQQAALLRILSKF--DRKIVAPKFELIG------SRFFYIEDETRRNWTSAGSA 152
              ::.::..|...:..||..:...  ||:.:..:.::|.      |.|:|:.:|: ::||.:...
Zfish   100 HQLLTKITNLTENKDELLTNIENLLKDREQLIQQHQIIAGWTYFQSSFYYLSNES-KSWTDSRGD 163

  Fly   153 CRQMGTQLATIRSAEELAALRAKLNKERHYWLDITDLEKEGDFR-ISASGKRPNFLKWRA----G 212
            |:.....|.||.:.:|...:.. |.:.:.:|:.:||.||||.:: :..|.....|  |.:    .
Zfish   164 CKGRKADLITINNRQEQDFVMT-LTRNKEFWIGLTDSEKEGQWKWVDGSTLTTGF--WASFRSIT 225

  Fly   213 QPNNFSGNQHCV--------DLLDGLMYDNKCESLSYFICQ 245
            :||. ...::||        :|:..:  |:.|::...:||:
Zfish   226 EPNG-GTRENCVLTHLKRHPELIGWI--DHNCDASYQWICE 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 27/116 (23%)
si:ch73-111e15.1XP_005172686.1 CLECT_DC-SIGN_like 139..264 CDD:153060 31/132 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.