DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and si:dkey-187i8.2

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:XP_021335897.1 Gene:si:dkey-187i8.2 / 101882603 ZFINID:ZDB-GENE-121214-181 Length:635 Species:Danio rerio


Alignment Length:172 Identity:40/172 - (23%)
Similarity:77/172 - (44%) Gaps:30/172 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 DIVARLDRLESQQAALLR-----------ILSKFDRKIVAPKFEL--------IGSRFFYIEDET 142
            |:....|||.|:...|.:           ::.:.| ::...|.||        ..|..:::...|
Zfish   468 DLTKERDRLFSENIRLTKEREELSSNISDLIEQRD-QLTKEKTELSNMDGWVYFQSSLYFLSSLT 531

  Fly   143 RRNWTSAGSACRQMGTQLATIRSAEELAALRAKLNKERHYWLDITDLEKEGDFR-ISASGKRPNF 206
             ::|..:...|...|..|..|.:.:|...:. .:..:...|:.:||:|:||.:: :..|.:...|
Zfish   532 -KSWEESRKDCIARGADLVIINNGKEQEMVN-MICGDVLVWIGLTDIEEEGTWKWVDGSKQTSGF 594

  Fly   207 LKWRAGQPNNFSGN--QHCVDLLDGLMY-DNKCESLSYFICQ 245
            ..||:.:||   ||  ::|| |.|...: |::|...:.:||:
Zfish   595 RYWRSREPN---GNRKENCV-LTDAHGWIDHRCHEANKWICE 632

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 28/107 (26%)
si:dkey-187i8.2XP_021335897.1 SMC_N <113..507 CDD:330553 7/39 (18%)
CLECT_DC-SIGN_like 515..633 CDD:153060 30/124 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.