DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and Clec3b

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:XP_003750657.1 Gene:Clec3b / 100912012 RGDID:1311031 Length:202 Species:Rattus norvegicus


Alignment Length:198 Identity:49/198 - (24%)
Similarity:81/198 - (40%) Gaps:27/198 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 SVLQANATEARLARIETLQTAMN--IRQKVLQEGFPKDIVARLDRLESQQAALLRILSKFDRKIV 124
            |.|....||:...:.:...||..  :..|:.:|     :..|||.| :|:.|||:  .|...:.|
  Rat    14 SFLSQATTESPTPKTKKAATAKKDLVSPKMFEE-----LKNRLDVL-AQEVALLK--EKQALQTV 70

  Fly   125 APKFELIGSR--FFYIEDETRRNWTSAGSACRQMGTQLATIRSAEELAAL----RAKLNKERHYW 183
            ..|...:..:  ..:.:.:|   :..|...|...|..|.|.:|..|..||    |..:..|...|
  Rat    71 CLKGTKVNLKCLLAFTQPKT---FHEASEDCISQGGTLGTPQSELENEALFEYARQSVGSEAELW 132

  Fly   184 LDITDLEKEGDFRISASGKRPNFLKWR---AGQPNNFSGNQHCVDL---LDGLMYDNKCESLSYF 242
            |.:.|:..||.: :..:|.|..:..|.   ..||:.... ::|..|   .:|..:|.:|.....:
  Rat   133 LGLNDMASEGAW-VDMTGGRLAYKNWETEITTQPDGGKA-ENCAALSGAANGKWFDKRCRDQLPY 195

  Fly   243 ICQ 245
            |||
  Rat   196 ICQ 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 28/113 (25%)
Clec3bXP_003750657.1 CLECT_tetranectin_like 71..199 CDD:153066 31/133 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.