DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and colec11

DIOPT Version :10

Sequence 1:NP_608629.3 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:XP_004914539.1 Gene:colec11 / 100493760 XenbaseID:XB-GENE-952506 Length:277 Species:Xenopus tropicalis


Alignment Length:152 Identity:38/152 - (25%)
Similarity:67/152 - (44%) Gaps:11/152 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 QAALLRILSKFDRKIVAPKFELIGSR------FFYIEDETRRNWTSAGSACRQMGTQLATIRSAE 167
            |.|.|....||.:..:.....:.|.|      :..:::|  :.:..|...|:..|..|:..:...
 Frog   128 QVAQLATEVKFVKNALPSPAVVAGVRETDTKIYLLVKEE--KKYIDAQDYCQGRGGTLSMPKDET 190

  Fly   168 ELAALRAKLNKE--RHYWLDITDLEKEGDFRISASGKRPNFLKWRAGQPNNFSGNQHCVDLL-DG 229
            ..:.:.:.:|:.  ...::.|.|||:||.|..|.......|.|||.|:|||....:.|.::: .|
 Frog   191 TNSLIASYINQAGLSRVFIGINDLEREGHFVYSDRSPMQTFNKWRQGEPNNAYDEEDCAEMVSSG 255

  Fly   230 LMYDNKCESLSYFICQSDDDSL 251
            ...|..|....||||:.|.:::
 Frog   256 GWNDVSCLITMYFICEFDKENV 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_608629.3 CLECT 141..245 CDD:153057 29/106 (27%)
colec11XP_004914539.1 Collagen <40..80 CDD:460189
CLECT_collectin_like 158..272 CDD:153061 30/115 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.