DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and illr2

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001121843.1 Gene:illr2 / 100147856 ZFINID:ZDB-GENE-050311-3 Length:253 Species:Danio rerio


Alignment Length:262 Identity:63/262 - (24%)
Similarity:98/262 - (37%) Gaps:77/262 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLLALFAWNAHAPSAAMPSVCLLQDAPQQCGEFCLTALSPMLDHIARHEGEWTSSV--LQANATE 70
            ||:||             :||||         |.|.|:..:...:||.|..:..||  .:.|||:
Zfish    41 LLIAL-------------TVCLL---------FALGAVCTLAVFMARTETHFNVSVSDQEHNATD 83

  Fly    71 ARLARIETLQTAMNIRQKVLQEGFPKDIVARLDRL-ESQQAALLRILSKFDRKIVAPKFELIGSR 134
            .:    |.|.......|::||         :|:|| ||...||           .|..:...|.:
Zfish    84 YK----EQLDVLHIQHQEMLQ---------KLNRLNESSGCAL-----------CAVHWTHSGGK 124

  Fly   135 FFYIEDETRRNWTSAGSACRQMGTQLATIRSAEELAALRAKLN------------KERHYWLDIT 187
            .:|. ...:.|||.:...|...|..|..|.|..|...|.:|::            :.|..|:|..
Zfish   125 CYYF-STVKMNWTQSRDHCVTKGGHLVIITSKAEQDFLASKISVTHWIGLNDMHTEGRWVWVDNQ 188

  Fly   188 DLEKEGDF---RISASGKRPNFLKWRAGQPNNFSGNQHCVDLLDGL-----MYDNKCESLSYFIC 244
            .|.|..:|   |::.:.:..|:.|       |..|.:.|..|...|     ..|:.|.:...|:|
Zfish   189 PLNKSVEFWMKRVNGNNEPDNWTK-------NHPGGEDCACLGHSLGATEFWNDDLCTATKRFVC 246

  Fly   245 QS 246
            ::
Zfish   247 EA 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 28/123 (23%)
illr2NP_001121843.1 CLECT_DC-SIGN_like 114..247 CDD:153060 31/140 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.