DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and mbl2

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_571645.2 Gene:mbl2 / 100008009 ZFINID:ZDB-GENE-000427-2 Length:251 Species:Danio rerio


Alignment Length:156 Identity:45/156 - (28%)
Similarity:77/156 - (49%) Gaps:7/156 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 GFP-KDIVARLDRLESQQAALLRILSKFDRKIVAPKFELIGSRFFYIEDETRRNWTSAGSACRQM 156
            |.| :|.::  |.|:|:...|...::..::.:....|:.:|.: :|:.|:....:......|...
Zfish    96 GLPGQDCMS--DSLKSELQKLSDKIALIEKVVNFKTFKKVGQK-YYVTDDVEETFDKGMQYCSSN 157

  Fly   157 GTQLATIRSAEELAALRAKLNKE-RHYWLDITDLEKEGDFRISASGKRPNFLKWRAGQPNNFSGN 220
            |..|...|:.||.|.|:..::.. :..::.|||.||||:| :....|:..|..|...||:|:.|.
Zfish   158 GGALVLPRTLEENALLKVFVSSAFKRLFIRITDREKEGEF-VDTDRKKLTFTNWGPNQPDNYKGA 221

  Fly   221 QHCVDLLD-GLMYDNKCESLSYFICQ 245
            |.|..:.| ||..|..|:||...||:
Zfish   222 QDCGAIADSGLWDDVSCDSLYPIICE 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 33/105 (31%)
mbl2NP_571645.2 CLECT_collectin_like 135..248 CDD:153061 36/115 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I10963
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5252
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm25445
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.