DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and si:dkey-83f18.2

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001093539.1 Gene:si:dkey-83f18.2 / 100000851 ZFINID:ZDB-GENE-070705-501 Length:360 Species:Danio rerio


Alignment Length:123 Identity:34/123 - (27%)
Similarity:58/123 - (47%) Gaps:12/123 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 ELIGSRFFYIEDETRRNWTSAGSACRQMGTQLATIRSAEELAALRAKLNKERHYWLDITDLEKEG 193
            |.:..::.:|.:  .:.||.|...||:..|.|||:.:..::..|...:|..| .|:   .|:::.
Zfish    19 ECVQRQYHFINE--NKTWTEAQRYCREKYTDLATVDNMNDMIQLMKSVNDVR-LWI---GLQRKW 77

  Fly   194 DFRISASGKRPNFLKWRAGQPNNFSGNQHCVDLLDGLMYDNKCESLSYFICQSDDDSL 251
            .:   :||....||.|.:|||:   |...|..:.:|...|.||....:|||.:....|
Zfish    78 QW---SSGDPALFLNWASGQPD---GRDECAFMKNGEWQDGKCSDTWFFICYNMSSGL 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 30/103 (29%)
si:dkey-83f18.2NP_001093539.1 CLECT_1 23..124 CDD:153072 32/112 (29%)
CLECT_1 129..239 CDD:153072 1/1 (100%)
CLECT 245..357 CDD:153057
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1345294at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.