DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15358 and asgrl1

DIOPT Version :9

Sequence 1:NP_001303306.2 Gene:CG15358 / 33366 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001107113.1 Gene:asgrl1 / 100000463 ZFINID:ZDB-GENE-081105-120 Length:270 Species:Danio rerio


Alignment Length:131 Identity:34/131 - (25%)
Similarity:58/131 - (44%) Gaps:24/131 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 YIEDETRRNWTSAGSACRQMGTQLATIRSAEELAALRAKLNKERHYWLDITDLEKEGDF------ 195
            |.:...:|||.:|.|.|.|.|:.|..:....||..|.:.:.....||:.:.:.| ||.:      
Zfish   146 YFQSTMKRNWKTAESNCIQKGSHLVVVNDLAELDFLSSIVKLSDSYWIGLVEKE-EGQWSWVDGT 209

  Fly   196 RISASGKRPNFLKWRAGQPNNFS--------GNQHCVDLLD--GLMYDNKCESLSY-FICQSDDD 249
            ..||:...     |..|||:::.        |..|..::::  .:..|..| :||| :||:.:..
Zfish   210 EFSATEHH-----WDVGQPDDWDVRVNGEDCGQLHSREIVNRRRMWNDADC-TLSYPYICEGNPK 268

  Fly   250 S 250
            |
Zfish   269 S 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15358NP_001303306.2 CLECT 141..245 CDD:153057 31/120 (26%)
asgrl1NP_001107113.1 CLECT_DC-SIGN_like 134..264 CDD:153060 32/124 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X73
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.