DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7295 and DAP1

DIOPT Version :9

Sequence 1:NP_001259885.1 Gene:CG7295 / 33365 FlyBaseID:FBgn0031372 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_015155.1 Gene:DAP1 / 855933 SGDID:S000006091 Length:152 Species:Saccharomyces cerevisiae


Alignment Length:100 Identity:25/100 - (25%)
Similarity:42/100 - (42%) Gaps:17/100 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 KQLAKYNSAHPDKIYLVALHEVIFDVSSAEHIFGPGGEHDKLTGTEIS----------DFIK--K 122
            :.|:|:| .|.|:...:|:...::|.:.....:||.|.:....|.:.|          |.||  .
Yeast    47 RTLSKFN-GHDDEKIFIAIRGKVYDCTRGRQFYGPSGPYTNFAGHDASRGLALNSFDLDVIKDWD 110

  Fly   123 QAIFLMRDTNSN----FEEWKMILEDFFYPAGTLI 153
            |.|..:.|....    .:||:...|:.:...||||
Yeast   111 QPIDPLDDLTKEQIDALDEWQEHFENKYPCIGTLI 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7295NP_001259885.1 None
DAP1NP_015155.1 Cyt-b5 46..108 CDD:395121 14/61 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.