DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7295 and MAPR4

DIOPT Version :9

Sequence 1:NP_001259885.1 Gene:CG7295 / 33365 FlyBaseID:FBgn0031372 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_567451.1 Gene:MAPR4 / 827155 AraportID:AT4G14965 Length:245 Species:Arabidopsis thaliana


Alignment Length:190 Identity:33/190 - (17%)
Similarity:72/190 - (37%) Gaps:28/190 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 IQFREVVNSPYVIIALTCVLGYVAYMNTRRQRGTYDDEDYENEGHRKLPNPLTGLRLNRKQLAKY 75
            |..|..:.||:|.:....||..:.:      |.::....::.:  ::|        .:.::||.|
plant     2 IPARRFLLSPFVGVTFIVVLVSLYF------RSSFKSPQHQYQ--KRL--------FSAEELALY 50

  Fly    76 NSAHPDKIYLVALHEVIFDVSSAEHIFGPGGEHDKLTGTEIS----------DFIKKQAIFLMRD 130
            |........|:.:...:|||:..:..:|.||.::...|.:.|          |.:......|...
plant    51 NGTDETLPILLGILGSVFDVTKGKFHYGSGGGYNHFAGRDASRAFVSGNFTGDGLTDSLQGLSSS 115

  Fly   131 TNSNFEEWKMILEDFFYPAGTLID--FEKKNLTTDVVDKMDSIVEESSEGDDKSGHEEQK 188
            ...:..:|:......:.|.|.|:.  ::.:...|..:...::.....::..:|...||.|
plant   116 EVKSIVDWRGFYSRTYTPVGKLVGRYYDSQGNPTKHLKGAEAKASRGAQLMEKQKTEEAK 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7295NP_001259885.1 None
MAPR4NP_567451.1 Cyt-b5 41..>95 CDD:278597 14/61 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.