DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7295 and pgrmc1

DIOPT Version :9

Sequence 1:NP_001259885.1 Gene:CG7295 / 33365 FlyBaseID:FBgn0031372 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001006842.1 Gene:pgrmc1 / 448590 XenbaseID:XB-GENE-6082492 Length:177 Species:Xenopus tropicalis


Alignment Length:179 Identity:41/179 - (22%)
Similarity:74/179 - (41%) Gaps:38/179 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 REVVNSPYVIIALTCVLGYVAYMNTRRQRGTYDDEDYENEGHRKLPNPLTGLRLNRK-----QLA 73
            :|:..|| :.|.|.|:..|:.|   :..||........||  .:||      ::.|:     :|.
 Frog     8 QEIFTSP-LNICLLCLCLYLLY---KILRGDKPQTTENNE--EQLP------KMKRRDFTPAELK 60

  Fly    74 KYNSAHPDKIYLVALHEVIFDVSSAEHIFGPGGEHDKLTGTEISD-----FIKKQAIFLMRDT-- 131
            :|:.....:| |:|:...:|||:..:..:||.|.:....|.:.|.     .:.|:|   ::||  
 Frog    61 EYDGVQNPRI-LMAISGKVFDVTRGKKFYGPEGPYGVFAGRDASRGLATFCLDKEA---LKDTYD 121

  Fly   132 ---------NSNFEEWKMILEDFFYPAGTLI-DFEKKNLTTDVVDKMDS 170
                     .....:|:......::..|.|: |.|:....||..|..|:
 Frog   122 DLSDLTATQRETLSDWEAQFTFKYHHVGKLLKDGEEPTEYTDDEDAKDT 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7295NP_001259885.1 None
pgrmc1NP_001006842.1 Cyt-b5 55..118 CDD:395121 15/66 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.