DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7295 and CG12056

DIOPT Version :9

Sequence 1:NP_001259885.1 Gene:CG7295 / 33365 FlyBaseID:FBgn0031372 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_572535.1 Gene:CG12056 / 31855 FlyBaseID:FBgn0030099 Length:287 Species:Drosophila melanogaster


Alignment Length:307 Identity:57/307 - (18%)
Similarity:98/307 - (31%) Gaps:93/307 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 IIALTCVLGYVAYMNTRR--QRGTYDDEDYENEGHRKLPNPLT-------GLRLNRKQLAKYNSA 78
            :..:..|||.:.:...|:  :|.|   ::|.::..:....||.       |......:|||:|..
  Fly    14 LFVVAAVLGGIYHTEIRQFLRRQT---DNYLDQAGQDASIPLAFQAGDDIGTLFTPAELAKFNGE 75

  Fly    79 HPDKIYLVALHEVIFDVSSAEHIFGPGGEHDKLTGTEIS------DF------IKKQAIFLMRDT 131
            ...:...:||...:||||.....:|.|..::...|.:.|      ||      .....:.|..|.
  Fly    76 EEGRPLYLALLGSVFDVSRGIKHYGSGCSYNFFVGRDASVSFISGDFETYDPETADDVLTLKPDD 140

  Fly   132 NSNFEEWKMILEDFFYPAGTLID--FEKKNLTTDVVDKMDSIVEESSEGDDKSGHEEQKMEPERE 194
            ......|:...:..:...|.:|.  :::|...|....|...::|::.                  
  Fly   141 LIGLAGWRDFYQKDYVYKGRVIGRFYDEKGALTTYHHKFLELLEQAR------------------ 187

  Fly   195 PANELDSKLEVLIPEIPELHLGTADDPINSDCDSLRTAYDFPPGHDDRANEEEDEDDDENKGDVD 259
                 |:|.:|                     :.||..|   ||.:...:||.            
  Fly   188 -----DAKRQV---------------------EELRARY---PGCNIEWSEER------------ 211

  Fly   260 DEETWDEVGQGD---RSASASPRK-----NESITDGTLNDTIWNDTD 298
            ....|.....||   ||....|||     |:|.....:.|...::.|
  Fly   212 GTRVWCTTTSGDGKERSWIGYPRKLYSRGNKSFQCACVPDAELDEID 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7295NP_001259885.1 None
CG12056NP_572535.1 Cyt-b5 63..>117 CDD:278597 14/53 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.