DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7295 and Cyb5d2

DIOPT Version :9

Sequence 1:NP_001259885.1 Gene:CG7295 / 33365 FlyBaseID:FBgn0031372 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001007672.1 Gene:Cyb5d2 / 303293 RGDID:1359124 Length:263 Species:Rattus norvegicus


Alignment Length:227 Identity:49/227 - (21%)
Similarity:92/227 - (40%) Gaps:44/227 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 KQLAKYNSAHPDKIYLVALHEVIFDVSSAEHIFGPGGEHDKLTGTEIS------DFIKKQAIFLM 128
            ::||:|.....|....:||...::||||....:.||..:....|.:.|      |:.:..   |:
  Rat    41 EELARYRGGPGDPGLYLALLGRVYDVSSGRKHYEPGAHYSGFAGRDASRAFVTGDYSEAG---LV 102

  Fly   129 RDTNS-------NFEEWKMILEDFFYPAGTLID--FEKKNLTTDVVDKMDSIVEESSEGDDKSGH 184
            .|.|.       ....|....|..:...|.||.  :.|..|.|..:.:::::|.:..|.:::...
  Rat   103 DDVNGLSSSEILTLHNWLSFYEKNYVFVGRLIGRFYGKDGLPTSELTQVEAMVTKGMEANEQEQR 167

  Fly   185 EEQKMEP-EREPANELDSKL------------EVLIPEIPELHLGTADDPINSDCDSLRTAYDFP 236
            |:|:..| ..|.::...|:|            .:.:|.  :|:...|.:|   .|..:||.  .|
  Rat   168 EKQRFPPCNAEWSSAKGSRLWCSQKSGGVHRDWIGVPR--KLYKPGAKEP---HCVCVRTT--GP 225

  Fly   237 PGHDDRANEEEDEDDDENKGDVDDEETWDEVG 268
            |      ::::|.....|:||:|:....:..|
  Rat   226 P------SDQQDNPRHSNRGDLDNPNLEEYTG 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7295NP_001259885.1 None
Cyb5d2NP_001007672.1 Cyt-b5 37..>91 CDD:278597 14/49 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..247 9/35 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.