DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7295 and NENF

DIOPT Version :9

Sequence 1:NP_001259885.1 Gene:CG7295 / 33365 FlyBaseID:FBgn0031372 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_037481.1 Gene:NENF / 29937 HGNCID:30384 Length:172 Species:Homo sapiens


Alignment Length:187 Identity:38/187 - (20%)
Similarity:70/187 - (37%) Gaps:49/187 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 IIALTCVLGYVAYMNTRRQRGTYDDEDYENEGHRKLPNPL---TGLRL-NRKQLAKYNSAHPDKI 83
            :.||..||.....:.|.|...|              |.|.   ..:|| ..::||:|.....|:.
Human    13 LAALALVLALAPGLPTARAGQT--------------PRPAERGPPVRLFTEEELARYGGEEEDQP 63

  Fly    84 YLVALHEVIFDVSSAEHIFGPGGEHDKLTGTEISDFIKKQAI---FLMRDTNSNFEEWKMILEDF 145
            ..:|:..|:|||:|.:..:|.|..::.|||.:.:..:.|.::   .|..||.....:....|::.
Human    64 IYLAVKGVVFDVTSGKEFYGRGAPYNALTGKDSTRGVAKMSLDPADLTHDTTGLTAKELEALDEV 128

  Fly   146 F-------YPAGTLIDFEKKNLTTDVVDKMDSIVEESSEGDDKSGHEEQKMEPEREP 195
            |       ||   ::.:..:.:.                  ::.|......:||.:|
Human   129 FTKVYKAKYP---IVGYTARRIL------------------NEDGSPNLDFKPEDQP 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7295NP_001259885.1 None
NENFNP_037481.1 Cyt-b5 48..>109 CDD:365921 16/60 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 151..172 4/14 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.