DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7295 and Nenf

DIOPT Version :9

Sequence 1:NP_001259885.1 Gene:CG7295 / 33365 FlyBaseID:FBgn0031372 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001002851.1 Gene:Nenf / 289380 RGDID:1303289 Length:171 Species:Rattus norvegicus


Alignment Length:153 Identity:31/153 - (20%)
Similarity:63/153 - (41%) Gaps:35/153 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 KLPNPL---TGLRL-NRKQLAKYNSAHPDKIYLVALHEVIFDVSSAEHIFGPGGEHDKLTGTEIS 117
            ::|.|.   ..:|| ..::||:|:....|:...:|:..|:|||:|.:..:|.|..::.|.|.:.|
  Rat    32 QMPRPAERGPPVRLFTEEELARYSGEEEDQPIYLAVKGVVFDVTSGKEFYGRGAPYNALAGKDSS 96

  Fly   118 DFIKKQAI---FLMRDTNSNFEEWKMILEDFF-------YPAGTLIDFEKKNLTTDVVDKMDSIV 172
            ..:.|.::   .|..|.:....:....|:|.|       ||   ::.:..:.:.           
  Rat    97 RGVAKMSLDPADLTHDISGLTAKELEALDDIFSKVYKAKYP---IVGYTARRIL----------- 147

  Fly   173 EESSEGDDKSGHEEQKMEPEREP 195
                   ::.|......:||.:|
  Rat   148 -------NEDGSPNLDFKPEDQP 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7295NP_001259885.1 None
NenfNP_001002851.1 Cyt-b5 45..>100 CDD:278597 16/54 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 151..171 4/13 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.