DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7295 and Cyb5d2

DIOPT Version :9

Sequence 1:NP_001259885.1 Gene:CG7295 / 33365 FlyBaseID:FBgn0031372 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001020097.2 Gene:Cyb5d2 / 192986 MGIID:2684848 Length:263 Species:Mus musculus


Alignment Length:237 Identity:53/237 - (22%)
Similarity:96/237 - (40%) Gaps:45/237 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 PLTGLRL-NRKQLAKYNSAHPDKIYLVALHEVIFDVSSAEHIFGPGGEHDKLTGTEIS------D 118
            |..|:|| ..::||:|.....|....:||...::||||....:.||..:....|.:.|      |
Mouse    31 PRPGIRLFLPEELARYRGGPGDPGLYLALLGRVYDVSSGRRHYEPGAHYSGFAGRDASRAFVTGD 95

  Fly   119 FIKKQAIFLMRDTNS-------NFEEWKMILEDFFYPAGTLID--FEKKNLTTDVVDKMDSIVEE 174
            :.:..   |:.|.|.       ....|....|..:...|.|:.  :.|..|.|..:.:::::|.:
Mouse    96 YSEAG---LVDDINGLSSSEILTLHNWLSFYEKNYVFVGRLVGRFYRKDGLPTSELTQVEAMVTK 157

  Fly   175 SSEGDDKSGHEEQKMEP-EREPANELDSKL------------EVLIPEIPELHLGTADDPINSDC 226
            ..|.:::...|:||..| ..|.::...|:|            .:.:|.  :|:...|.:|   .|
Mouse   158 GMEANEQEQREKQKFPPCNSEWSSAKGSRLWCSQKSGGVHRDWIGVPR--KLYKPGAKEP---HC 217

  Fly   227 DSLRTAYDFPPGHDDRANEEEDEDDDENKGDVDDEETWDEVG 268
            ..:||.  .||      ::::|.....|.||:|:....:..|
Mouse   218 VCVRTT--GPP------SDQQDNPRHSNHGDLDNPNLEEYTG 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7295NP_001259885.1 None
Cyb5d2NP_001020097.2 Cyt-b5 37..>91 CDD:278597 15/53 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 220..249 9/36 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.