DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment wry and acana

DIOPT Version :9

Sequence 1:	NP_995611.2	Gene:	wry / 33361	FlyBaseID:	FBgn0051665	Length:	1157	Species:	Drosophila melanogaster
Sequence 2:	XP_005166542.1	Gene:	acana / 497505	ZFINID:	ZDB-GENE-050208-221	Length:	1547	Species:	Danio rerio

Alignment Length:	107	Identity:	35/107 - (32%)
Similarity:	49/107 - (45%)	Gaps:	11/107 - (10%)

- Green bases have known domain annotations that are detailed below.

  Fly   812 PLCQHSLNECESSPCVHGICVDQEDGFRCFCQPGFAGELCNFEYNECESNPCQNGGECIDHIGSY 876
            |.....||.||.:||..|:|..::....|.|.||..||.|.||.:.|.||||.||..|::...::
Zfish  1253 PAVNDYLNPCEPNPCGAGVCSVKDGVGLCHCPPGLHGEECQFEVDVCHSNPCANGATCVEVEDTF 1317

  Fly   877 ECRCTKGFSGNRCQIKVDFCANKPCPEGHRCIDHGNDFSCEC 918
            :|.|...:.|:||:           .:.|.|......|...|
Zfish  1318 KCLCLPSYEGDRCE-----------TDSHSCEKGWTKFQGNC 1348

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
wry	NP_995611.2	EGF_CA	737..777	CDD:238011
		EGF	783..812	CDD:278437	35/107 (33%)
		EGF_CA	819..851	CDD:238011	13/31 (42%)
		EGF_CA	856..890	CDD:238011	12/33 (36%)
		EGF_CA	893..927	CDD:238011	4/26 (15%)
		EGF_CA	<941..970	CDD:238011
acana	XP_005166542.1	Ig	45..156	CDD:299845
		Link_domain_CSPGs_modules_1_3	155..249	CDD:239594
		Link_domain_CSPGs_modules_2_4	256..351	CDD:239597
		Link_domain_CSPGs_modules_1_3	460..555	CDD:239594
		Link_domain_CSPGs_modules_2_4	562..657	CDD:239597
		EGF	1299..1329	CDD:278437	11/29 (38%)
		CLECT_CSPGs	1337..1460	CDD:153058	3/12 (25%)
		CCP	1464..1521	CDD:153056
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.910