DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wry and Ser

DIOPT Version :9

Sequence 1:NP_995611.2 Gene:wry / 33361 FlyBaseID:FBgn0051665 Length:1157 Species:Drosophila melanogaster
Sequence 2:NP_001287558.1 Gene:Ser / 43275 FlyBaseID:FBgn0004197 Length:1407 Species:Drosophila melanogaster


Alignment Length:606 Identity:153/606 - (25%)
Similarity:216/606 - (35%) Gaps:189/606 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   497 TSTSTSTTTTMATLLATARTRPSAANPTKTASKPIARPRILSRLQEK--------------INSL 547
            |.|..::..|.|.:..|:..|.:...|.:.:|.    .|.|..|:.:              :.||
  Fly   404 TCTLKTSNRTQAQVYRTSHGRSNMGRPVRRSSS----MRSLDHLRPEGQALNGSSSPGLVSLGSL 464

  Fly   548 ECE---IPNVPQDSHL-WRGNETHELLLPIVTTEHCK--PDEH---CVPNVLTWRGEAEIQ-SGD 602
            :.:   .|:...|... |.| .|.|     :..:.|.  |.||   |:..:..:|.|...: .||
  Fly   465 QLQQQLAPDFTCDCAAGWTG-PTCE-----INIDECAGGPCEHGGTCIDLIGGFRCECPPEWHGD 523

  Fly   603 ILIVEINDAMLNPSHEPNNTSSAVHATQVYQVTRSGHEHCDVTEGVLLDITPLVVDGRKL-VTLY 666
            :..|::|:.     ..|::...|.:|                    ||..|...:.|..| .|..
  Fly   524 VCQVDVNEC-----EAPHSAGIAANA--------------------LLTTTATAIIGSNLSSTAL 563

  Fly   667 DKDLTEGV---------------------NLLIVVSELWGAQCVRLKVTTKTDNCGENA-DCSGK 709
            ...||..|                     :...:..|.||.      ||     |.||. ||.|:
  Fly   564 LAALTSAVASTSLAIGPCINAKECRNQPGSFACICKEGWGG------VT-----CAENLDDCVGQ 617

  Fly   710 GVCYSNSG----MEEYECQCCSGFAGPHCE-EIDACNPSPCTNNGICVDLSQGHEGNSYQCLCPY 769
              |.:.:.    :.:|.|.|.|||.|..|| :||.|..|||.|.|.|||:.     ..:.|:||.
  Fly   618 --CRNGATCIDLVNDYRCACASGFKGRDCETDIDECATSPCRNGGECVDMV-----GKFNCICPL 675

  Fly   770 GYAGKNCQYESDPCNPAECMNG------------------------------------------- 791
            ||:|..|:...:.|.|:.|:.|                                           
  Fly   676 GYSGSLCEEAKENCTPSPCLEGHCLNTPEGYYCHCPPDRAGKHCEQLRPLCSQPPCNEGCFANVS 740

  Fly   792 --------------------------------GSCVGNSTHFRCDCAPGFTGPLCQHSLNECESS 824
                                            |||..:.....|.|..|.||..|:|:||||..:
  Fly   741 LATSATTTTTTTTTATTTRKMAKPSGLPCSGHGSCEMSDVGTFCKCHVGHTGTFCEHNLNECSPN 805

  Fly   825 PCVH-GICVDQEDGFRCFCQPGFAGELCNFEYNECESNPCQNGGECI----DHIGSYECRCTKGF 884
            ||.: |||:|.:..|.|.|..|:.|:.|:.....|.:..|||||.|:    |......|||..|:
  Fly   806 PCRNGGICLDGDGDFTCECMSGWTGKRCSERATGCYAGQCQNGGTCMPGAPDKALQPHCRCAPGW 870

  Fly   885 SGNRCQIKVDFCANKPCPEGHRCIDHGNDFSCECPGGRNGPDCNQMPRTYFQQCNVNPCTHGGTC 949
            :|..|...:|.|..:||..|..|......|.|.|..|.:||||    |....:|:..||..|.||
  Fly   871 TGLFCAEAIDQCRGQPCHNGGTCESGAGWFRCVCAQGFSGPDC----RINVNECSPQPCQGGATC 931

  Fly   950 WSSGDSFYCACRPGYTGTMCE 970
            ......:.|.|.||..|..||
  Fly   932 IDGIGGYSCICPPGRHGLRCE 952

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wryNP_995611.2 EGF_CA 737..777 CDD:238011 17/39 (44%)
EGF 783..812 CDD:278437 11/103 (11%)
EGF_CA 819..851 CDD:238011 14/32 (44%)
EGF_CA 856..890 CDD:238011 13/37 (35%)
EGF_CA 893..927 CDD:238011 12/33 (36%)
EGF_CA <941..970 CDD:238011 10/28 (36%)
SerNP_001287558.1 MNNL 83..161 CDD:284966
DSL 220..282 CDD:279722
EGF_CA 350..388 CDD:238011
EGF_CA 490..526 CDD:238011 9/35 (26%)
EGF_CA 610..645 CDD:238011 12/36 (33%)
EGF_CA 647..683 CDD:238011 17/40 (43%)
EGF_CA 798..833 CDD:238011 15/34 (44%)
EGF_CA 879..913 CDD:238011 12/33 (36%)
EGF_CA 916..952 CDD:238011 11/35 (31%)
VWC_out <993..1053 CDD:214565
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24044
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.