DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wry and Notch4

DIOPT Version :9

Sequence 1:NP_995611.2 Gene:wry / 33361 FlyBaseID:FBgn0051665 Length:1157 Species:Drosophila melanogaster
Sequence 2:NP_001002827.1 Gene:Notch4 / 406162 RGDID:1303282 Length:1961 Species:Rattus norvegicus


Alignment Length:588 Identity:163/588 - (27%)
Similarity:218/588 - (37%) Gaps:172/588 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   510 LLATARTRPSAANPTKTASKPIARPRILSRLQEKINSLECEIPNVPQDSHLWRGNETHELLLPIV 574
            ||.||   ||:.:||    .|:. |..............|:.|             ..||..|..
  Rat    80 LLPTA---PSSHSPT----SPLT-PHFSCTCPSGFTGDRCQSP-------------LEELCPPSF 123

  Fly   575 TTE--HC------KPDEHCVPNVLTWRGE-----------------------AEIQ-------SG 601
            .:.  ||      :|...|.|.   |.||                       .:||       .|
  Rat   124 CSNGGHCSVQVSGRPQCSCEPG---WTGEQCQLRDFCSANPCANGGVCLATYPQIQCRCPTGFEG 185

  Fly   602 DILIVEINDAMLNPSHEPNNTSSAVHATQ-----VYQVTRSGHEHCDVTEGVLLDITPLVVDGRK 661
            .|...::|:..|.|...|..||  .|.|.     :..|.:.|.: |.:.:|..|..|.|  :|..
  Rat   186 HICERDVNECFLEPGPCPRGTS--CHNTLGSFQCLCPVGQEGPQ-CKLRKGACLPGTCL--NGGT 245

  Fly   662 LVTLYDKDLT----------EGVNLLIVVSELWGAQCVRLKV-------------------TTKT 697
            ...:.:.|.|          .|:|     .|:....|||.:.                   |.|.
  Rat   246 CQLVPEGDTTFHLCLCPPGFTGLN-----CEMNPDDCVRNQCQNGATCQDGLGTYTCLCPKTWKG 305

  Fly   698 DNCGENAD---------CSGKGVCYSNSGMEEYECQCCSGFAGPHCEE-IDACNPSPCTNNGICV 752
            .:|.|:.|         |...|.|.:::|  .:.|.|.||:.|..|:| :|.|..:.|.....|:
  Rat   306 WDCSEDIDECEAQGPPRCRNGGTCQNSAG--GFHCVCVSGWGGEGCDENLDDCAAATCALGSTCI 368

  Fly   753 DLSQGHEGNSYQCLCP---------------------------------------YGYAGKNCQY 778
            |     ...|:.||||                                       .||:|..|..
  Rat   369 D-----RVGSFSCLCPPGRTGLLCHLEDMCLRQPCHVNAQCSTNPLTGSTLCICQPGYSGPTCHQ 428

  Fly   779 ESDPC-----NPAECMNGGSCVGNSTHFRCDCAPGFTGPLCQHSLNECESSPCVHG-ICVDQEDG 837
            :.|.|     .|:.|.:||||:.....|.|.|.||:||..|:...|||.|.||..| .|:|....
  Rat   429 DLDECQMAQQGPSPCEHGGSCINTPGSFNCLCLPGYTGSRCEADHNECLSQPCHPGSTCLDLLAT 493

  Fly   838 FRCFCQPGFAGELCNFEYNECESNPCQNGGECIDHIGSYECRCTKGFSGNRCQIKVDFCANKPCP 902
            |:|.|.||..|.||..|.|||.||||.|...|.|.:..:.|.|..||:|.||:..:|.|::.||.
  Rat   494 FQCLCPPGLEGRLCEVEINECASNPCLNQAACHDQLNGFLCLCLPGFTGARCEKDMDECSSAPCA 558

  Fly   903 EGHRCIDHGNDFSCECPGGRNGPDCNQMPRTYFQQCNVNPCTHGGTCWSSGDSFYCACRPGYTGT 967
            .|..|.|....|.|||..|..||.|    .|...:|..:||..|.:|.....:|.|.||||:||.
  Rat   559 NGGHCQDQPGAFHCECLPGFEGPRC----ETEADECRSDPCPVGASCLDLPGAFLCLCRPGFTGQ 619

  Fly   968 MCE 970
            :||
  Rat   620 LCE 622

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wryNP_995611.2 EGF_CA 737..777 CDD:238011 13/78 (17%)
EGF 783..812 CDD:278437 13/33 (39%)
EGF_CA 819..851 CDD:238011 15/32 (47%)
EGF_CA 856..890 CDD:238011 16/33 (48%)
EGF_CA 893..927 CDD:238011 14/33 (42%)
EGF_CA <941..970 CDD:238011 12/28 (43%)
Notch4NP_001002827.1 EGF_CA 191..>224 CDD:284955 9/34 (26%)
EGF_CA 311..349 CDD:238011 10/39 (26%)
EGF_CA 352..387 CDD:238011 10/39 (26%)
EGF_CA 429..470 CDD:238011 15/40 (38%)
EGF_CA 472..508 CDD:238011 16/35 (46%)
EGF_CA 511..546 CDD:238011 16/34 (47%)
EGF_CA 548..584 CDD:238011 15/39 (38%)
EGF_CA 588..622 CDD:238011 13/33 (39%)
EGF_CA <696..723 CDD:238011
EGF_CA 765..800 CDD:238011
EGF_CA <810..839 CDD:238011
EGF_CA 892..924 CDD:238011
EGF_CA 927..961 CDD:238011
EGF_CA 966..1000 CDD:238011
EGF_CA 1002..1040 CDD:238011
Notch 1207..1242 CDD:278494
Notch 1245..1281 CDD:278494
NOD 1291..1337 CDD:284282
NODP 1376..>1415 CDD:284987
Ank_2 <1571..1656 CDD:289560
ANK 1625..1732 CDD:238125
ANK repeat 1626..1656 CDD:293786
Ank_2 1630..1723 CDD:289560
ANK repeat 1658..1690 CDD:293786
ANK 1687..1811 CDD:238125
ANK repeat 1692..1723 CDD:293786
Ank_2 1697..1789 CDD:289560
ANK repeat 1725..1756 CDD:293786
ANK repeat 1758..1789 CDD:293786
ANK repeat 1791..1827 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D7525at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.